PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000294643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 342aa    MW: 37582.5 Da    PI: 7.518
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000294643genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.2e-3258115260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  MDP0000294643  58 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 115
                    8****************************************.***************85 PP

2WRKY55.21.4e-171812172359
                    EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    sYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  MDP0000294643 181 SYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 217
                    9***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182903.92E-2556116IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.6E-2757116IPR003657WRKY domain
SMARTSM007744.1E-3457115IPR003657WRKY domain
PROSITE profilePS5081127.23258219IPR003657WRKY domain
PfamPF031068.0E-2558114IPR003657WRKY domain
SMARTSM007744.8E-13149218IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-17180219IPR003657WRKY domain
SuperFamilySSF1182909.29E-14181219IPR003657WRKY domain
PfamPF031068.3E-13181217IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAVSSNELSL SAPVHTGGAS APVEDDSGDL TQREHPHPGV QTSQGDNKGN GPSVISSDDG  60
YNWRKYGQKH VKGSEFPRSY YKCTHPNCEV KKLFERSHDG QITEIIYKGT HDHPKPQPSR  120
RYNTGAMMPA QEERSDKASS LTGQDVNIQK EVLNNGTFTK IVVVLLNIAQ LARSLTSLIV  180
SYYKCTNAGC PVRKHVERAS HDPKAVITTY EGKHNHDVPT AKSSSHDTSG PTTVNVPSRI  240
RPEESDTISL DLGVGMTSGG EIRTNEHVQL HSDLVERQSH TNSNFRFAQN TPVSTYYGVL  300
NGGMNQYGSR ENPSESRSME ILPLNHSSYP YPQNMGRVLT GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-17582191574WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.250281e-157leaf
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342208.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
RefseqXP_008342210.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV06e-55WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s37260.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-56WRKY family protein